(data stored in ACNUC7421 zone)

EMBL: CP000462.PE421

CP000462.PE421       Location/Qualifiers
FT   CDS             476309..478207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF2"
FT                   /protein_id="ABK38863.1"
FT                   /translation="MVYVMIRQITITNFRSIRKETISTEEITTFVGKNDAGKSNLLRAL
FT                   NLFFNGKTDADTDYNFQSDFNINAIVQQRKAKEIKVELVLKLPRSYRKPDQPDTVYWSK
FT                   IWRADGFHDEVQQHCEVKGGAVVNKRNFPKRSKIPSLLKSINYIYIPAIKDANFFRDLQ
FT                   GKLYDVLAISSEQGLHASANSFEQEINEHISELMGEIDTVFASSNNEIKLPQNLRNIFG
FT                   ALEFKADNIPLSRRGDGIKIRHIPMMLSFIALKQQSIGAKITIRPQIWGFEEPENNVEF
FT                   STCFELNNQLIEAAKKHTQMFITTHSPAIYSLSFNASLPSGLKSISYYVDKKGHDTKLQ
FT                   SCSEQDLHGNTGFLNLVTPLIEEHRKVWQERESEYKKTLGVLSSQLAASSKPRVFLEGM
FT                   SDSVVINRILQFLNKADEIFIDVPDNAHNSANAASDRAKAFYLLQKHEKTKVLGLLLLD
FT                   DDPAGKEAKNQFTEFFKGQQSTVSAATYPPHDAPKKLKLKGYIWRVELEHLYPECIWQH
FT                   ALEQSWIEEVTDEEQKFTDNKRKELFNTGVSPITYKADLTDYQRFIVDYAFTHQGKRDV
FT                   SQYIDNMTDDELFEKGLVAAFEPVIEMILKKLKLSPIASEISASEDSETSPIWTGT"
     MVYVMIRQIT ITNFRSIRKE TISTEEITTF VGKNDAGKSN LLRALNLFFN GKTDADTDYN        60
     FQSDFNINAI VQQRKAKEIK VELVLKLPRS YRKPDQPDTV YWSKIWRADG FHDEVQQHCE       120
     VKGGAVVNKR NFPKRSKIPS LLKSINYIYI PAIKDANFFR DLQGKLYDVL AISSEQGLHA       180
     SANSFEQEIN EHISELMGEI DTVFASSNNE IKLPQNLRNI FGALEFKADN IPLSRRGDGI       240
     KIRHIPMMLS FIALKQQSIG AKITIRPQIW GFEEPENNVE FSTCFELNNQ LIEAAKKHTQ       300
     MFITTHSPAI YSLSFNASLP SGLKSISYYV DKKGHDTKLQ SCSEQDLHGN TGFLNLVTPL       360
     IEEHRKVWQE RESEYKKTLG VLSSQLAASS KPRVFLEGMS DSVVINRILQ FLNKADEIFI       420
     DVPDNAHNSA NAASDRAKAF YLLQKHEKTK VLGLLLLDDD PAGKEAKNQF TEFFKGQQST       480
     VSAATYPPHD APKKLKLKGY IWRVELEHLY PECIWQHALE QSWIEEVTDE EQKFTDNKRK       540
     ELFNTGVSPI TYKADLTDYQ RFIVDYAFTH QGKRDVSQYI DNMTDDELFE KGLVAAFEPV       600
     IEMILKKLKL SPIASEISAS EDSETSPIWT GT                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page