(data stored in ACNUC7421 zone)

EMBL: CP000462.PE424

CP000462.PE424       Location/Qualifiers
FT   CDS             complement(479899..480315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0448"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36853"
FT                   /db_xref="GOA:A0KFF5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF5"
FT                   /protein_id="ABK36853.1"
FT                   /translation="MHLTPPQPPAEQDVDALRIGLSGYNIGQAGTHLREHIASFIKDEA
FT                   GKVHGGITADLKWGWLHVDWLWIDERIRQDGWGGRLLATMEQYARSKGISNFHLETTSF
FT                   QALPFYQKQGYQVFGELPDMPPGHTTYFLRKMES"
     MHLTPPQPPA EQDVDALRIG LSGYNIGQAG THLREHIASF IKDEAGKVHG GITADLKWGW        60
     LHVDWLWIDE RIRQDGWGGR LLATMEQYAR SKGISNFHLE TTSFQALPFY QKQGYQVFGE       120
     LPDMPPGHTT YFLRKMES                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page