(data stored in ACNUC7421 zone)

EMBL: CP000462.PE425

CP000462.PE425       Location/Qualifiers
FT   CDS             complement(480428..480745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39519"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF6"
FT                   /protein_id="ABK39519.1"
FT                   /translation="MKRAIVKARFDAISIEGEQLTVKIAIRAPEPDPKSAGGDWRCKVK
FT                   LDGLGNKTFIYGVDALQALSLALKFVESELRAFTDAGWHFYLPGCPDHPVDMAACYFPQ
FT                   L"
     MKRAIVKARF DAISIEGEQL TVKIAIRAPE PDPKSAGGDW RCKVKLDGLG NKTFIYGVDA        60
     LQALSLALKF VESELRAFTD AGWHFYLPGC PDHPVDMAAC YFPQL                       105
//

If you have problems or comments...

PBIL Back to PBIL home page