(data stored in ACNUC7421 zone)

EMBL: CP000462.PE426

CP000462.PE426       Location/Qualifiers
FT   CDS             481080..481985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0450"
FT                   /product="GGDEF family protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38934"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF7"
FT                   /protein_id="ABK38934.1"
FT                   /translation="MALSVKQLYEVMAQLPDPVFILSEDGYYIEYIGGVEQQSYQDGNP
FT                   LAGKRLADVLPAAMTRWVMEQVTLALDSGQVQVVEYELAAVEVEGIDASVGPQGMQHFE
FT                   GKIAPLPSRYDGKRAVAWVTRNITRQYELQQRLKLQSETDQLTGLYNRRYFFEHCRQRR
FT                   AGEAPCALVMLDIDHFKQINDRFGHQQGDRALQRFCACVAAQLRADDMFVRSGGEEFLI
FT                   LLPGMSEPDLLALAERIRAAVAALPADPAAFTVSLGTTLVRPGEEINQALARADEWLYR
FT                   AKRAGRNRVAHCPVATGAQG"
     MALSVKQLYE VMAQLPDPVF ILSEDGYYIE YIGGVEQQSY QDGNPLAGKR LADVLPAAMT        60
     RWVMEQVTLA LDSGQVQVVE YELAAVEVEG IDASVGPQGM QHFEGKIAPL PSRYDGKRAV       120
     AWVTRNITRQ YELQQRLKLQ SETDQLTGLY NRRYFFEHCR QRRAGEAPCA LVMLDIDHFK       180
     QINDRFGHQQ GDRALQRFCA CVAAQLRADD MFVRSGGEEF LILLPGMSEP DLLALAERIR       240
     AAVAALPADP AAFTVSLGTT LVRPGEEINQ ALARADEWLY RAKRAGRNRV AHCPVATGAQ       300
     G                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page