(data stored in ACNUC7421 zone)

EMBL: CP000462.PE427

CP000462.PE427       Location/Qualifiers
FT   CDS             482444..483718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0451"
FT                   /product="serine transporter"
FT                   /note="identified by match to protein family HMM PF03222"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37080"
FT                   /db_xref="GOA:A0KFF8"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF8"
FT                   /protein_id="ABK37080.1"
FT                   /translation="MSVAIAEKSNPASKLKWEKSDSVWTMGLYATAVGAGTLFLPITVG
FT                   SNSPVILLFILLMAFPLSYYSHRALSRFVLSSSHREGDITHVVEEHFGARAGKLLMLVY
FT                   LMAFYPIILVYSISITNAIQSFVVHQLGNAEIPRGLLVLGVMLGLHLVLLAGKQIVVSA
FT                   ISVLALPMVAFLIGLSIYLLPQWSLSYFSESQGVDWRDPAFWKSLWLIVPVMVFSFSHA
FT                   PIISSFSAAQKKRCQASADQRAKRIIKCSSLLICGSVLFFVVSCVMSLSQAEMAQARID
FT                   NISVLSALANKFSNPLIAYVGPLIAILAMSKSFLGTSMGVSEGTVSMVNGACQGLGLSL
FT                   REATIARVSSVILFVVTGVITYLNPNVLEIIEKVSGPLIAVILFLLPACSIYRLPVLKR
FT                   YRGASTLFVLVIGLLAISALIYDLL"
     MSVAIAEKSN PASKLKWEKS DSVWTMGLYA TAVGAGTLFL PITVGSNSPV ILLFILLMAF        60
     PLSYYSHRAL SRFVLSSSHR EGDITHVVEE HFGARAGKLL MLVYLMAFYP IILVYSISIT       120
     NAIQSFVVHQ LGNAEIPRGL LVLGVMLGLH LVLLAGKQIV VSAISVLALP MVAFLIGLSI       180
     YLLPQWSLSY FSESQGVDWR DPAFWKSLWL IVPVMVFSFS HAPIISSFSA AQKKRCQASA       240
     DQRAKRIIKC SSLLICGSVL FFVVSCVMSL SQAEMAQARI DNISVLSALA NKFSNPLIAY       300
     VGPLIAILAM SKSFLGTSMG VSEGTVSMVN GACQGLGLSL REATIARVSS VILFVVTGVI       360
     TYLNPNVLEI IEKVSGPLIA VILFLLPACS IYRLPVLKRY RGASTLFVLV IGLLAISALI       420
     YDLL                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page