(data stored in ACNUC7421 zone)

EMBL: CP000462.PE428

CP000462.PE428       Location/Qualifiers
FT   CDS             complement(483782..484489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0452"
FT                   /product="protein ExoD"
FT                   /note="identified by match to protein family HMM PF06055"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39808"
FT                   /db_xref="GOA:A0KFF9"
FT                   /db_xref="InterPro:IPR010331"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF9"
FT                   /protein_id="ABK39808.1"
FT                   /translation="MPRMLTRNRLMVSRFNSPEGHQGMVAAQLNDPQNKLSDTLRATAH
FT                   AIEESHISLRQMLALVGEQGMLLFCVLLTVPFLLPVSIPGVSTPFGLLILFIGIGITLN
FT                   RVPWLPAILMERRFAAEQLKPTLHKGADLLARIDRFIRPRLLLLTGSSTINRCNGLLIM
FT                   LAALLLMLPLGAIPFTNAMPAWAILLLAIGMLQRDGLFVASGYLLVSATLIWFSALAIG
FT                   LLMAGQSVSTLLG"
     MPRMLTRNRL MVSRFNSPEG HQGMVAAQLN DPQNKLSDTL RATAHAIEES HISLRQMLAL        60
     VGEQGMLLFC VLLTVPFLLP VSIPGVSTPF GLLILFIGIG ITLNRVPWLP AILMERRFAA       120
     EQLKPTLHKG ADLLARIDRF IRPRLLLLTG SSTINRCNGL LIMLAALLLM LPLGAIPFTN       180
     AMPAWAILLL AIGMLQRDGL FVASGYLLVS ATLIWFSALA IGLLMAGQSV STLLG            235
//

If you have problems or comments...

PBIL Back to PBIL home page