(data stored in ACNUC7421 zone)

EMBL: CP000462.PE429

CP000462.PE429       Location/Qualifiers
FT   CDS             484671..485291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36126"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG0"
FT                   /protein_id="ABK36126.1"
FT                   /translation="MKRAGIMMMGLLLPLGQAWSAEGEAALGWQVTPFFGYSSAIDFEA
FT                   NDDPKPTPVSTRLESLQGERSGSWGLFISKEVDDPGMIELLYSHQSTRLSPDQPDRLTV
FT                   DTLHFAGALTLSDNLMAPYIGAGIGATRFAAYDSEVAPSMSLALGVQPRLTEHLALRAE
FT                   VRGYGSLVNDNSQFLCNPDQCVFKVRGELVTQWQANIGLTLRF"
     MKRAGIMMMG LLLPLGQAWS AEGEAALGWQ VTPFFGYSSA IDFEANDDPK PTPVSTRLES        60
     LQGERSGSWG LFISKEVDDP GMIELLYSHQ STRLSPDQPD RLTVDTLHFA GALTLSDNLM       120
     APYIGAGIGA TRFAAYDSEV APSMSLALGV QPRLTEHLAL RAEVRGYGSL VNDNSQFLCN       180
     PDQCVFKVRG ELVTQWQANI GLTLRF                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page