(data stored in ACNUC7421 zone)

EMBL: CP000462.PE432

CP000462.PE432       Location/Qualifiers
FT   CDS             486247..486612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0457"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01638"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37876"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG3"
FT                   /protein_id="ABK37876.1"
FT                   /translation="MSPLPCPAYRVLRLLAGKWKPAILFHLRAQILRFGDLRRSLPEVS
FT                   QKVLTAQLKELESDGVIIRTLYPDVPPRVEYSLSPLGIALLPLLQQMHDFALSHGSLLA
FT                   QSEAGAAREEPHLGEPG"
     MSPLPCPAYR VLRLLAGKWK PAILFHLRAQ ILRFGDLRRS LPEVSQKVLT AQLKELESDG        60
     VIIRTLYPDV PPRVEYSLSP LGIALLPLLQ QMHDFALSHG SLLAQSEAGA AREEPHLGEP       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page