(data stored in ACNUC7421 zone)

EMBL: CP000462.PE434

CP000462.PE434       Location/Qualifiers
FT   CDS             complement(487169..487858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36111"
FT                   /db_xref="InterPro:IPR016878"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG5"
FT                   /protein_id="ABK36111.1"
FT                   /translation="MGGKPIPPHSRLNGGFNFYSSQIDKLRVSLNATPRSHDRMKLLTK
FT                   TLFTKQSGLVLVLLAASGSLSAAQIANNNITEAEIKAAQDAWGKALIQISDDYRSGGID
FT                   KARATATAVLDGAYGYHHGPVLFKPTLAGGEQTFRINQAGALAYFVGNNQAYPADTGFA
FT                   LKNWQSYNYDNAAVYINGDMALTMGKVHLTDRDNKQTTVDKTWGFKKGDDGKVRIVLHH
FT                   SSLPYAG"
     MGGKPIPPHS RLNGGFNFYS SQIDKLRVSL NATPRSHDRM KLLTKTLFTK QSGLVLVLLA        60
     ASGSLSAAQI ANNNITEAEI KAAQDAWGKA LIQISDDYRS GGIDKARATA TAVLDGAYGY       120
     HHGPVLFKPT LAGGEQTFRI NQAGALAYFV GNNQAYPADT GFALKNWQSY NYDNAAVYIN       180
     GDMALTMGKV HLTDRDNKQT TVDKTWGFKK GDDGKVRIVL HHSSLPYAG                   229
//

If you have problems or comments...

PBIL Back to PBIL home page