(data stored in ACNUC7421 zone)

EMBL: CP000462.PE437

CP000462.PE437       Location/Qualifiers
FT   CDS             complement(489771..491813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0461"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36630"
FT                   /db_xref="GOA:A0KFG8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG8"
FT                   /protein_id="ABK36630.1"
FT                   /translation="MHTPHHPRTLLSVALLALSAGAHAEDETMTVVGKRSQHEEVATAT
FT                   RTNTPAKLVPQAIDSVKASELTAFGQPTLSEALTGIPGVNASGDTRFDGVNIRGFSASN
FT                   DFYLDGFRDDMQYTRDLGNTERVEVLKGPAAVLYGRGSTGGIVNRVSKKPQKGLESSVS
FT                   AQVGSFDSRRLAADLNGEAGEQVQVRLNLAQEDKDSFRNGVTSKRTLLAPSVNWEISDK
FT                   LNWLVQYERNEHDRTPDRGIPGVNGRPADVPKEYVYSDTRRDFIDDVAQSTRSRLTWDI
FT                   NDQWQLRQQLGYTSLDSQFDNTYVTSVKGDQVTRSRWQQDLKANSLISNTEAEGQLQTG
FT                   PVEHRLLVGFEQNWQERTPKLYQNATAIPAGNLYDPGSLPTYDGAMKLSSDANHKVRGY
FT                   GLYVQDQLSLGDWHLLAGLRRDDFTVTSRRNDLNKEETVSVTSLSPRLGLVWNPIEEHA
FT                   FYASYSKTFTPVGGELIGITPGDKNNNLDPQHTRLYEGGVKSDWLDGRLATTLSLYRLE
FT                   MYNKRSKDPLDPTKVILTGLQRTEGIELSARAQLTDELYLRGGIAIQDAEQVKADADLQ
FT                   GKRPMNVSRQNGELFAGYQSGKQGWFGETGVTAVGDRFADNANTTTLPGYARFDARAGY
FT                   RWQQWETQLSVENLTDHDYFVSATSASQIMPGTPRQLHLSAAYRF"
     MHTPHHPRTL LSVALLALSA GAHAEDETMT VVGKRSQHEE VATATRTNTP AKLVPQAIDS        60
     VKASELTAFG QPTLSEALTG IPGVNASGDT RFDGVNIRGF SASNDFYLDG FRDDMQYTRD       120
     LGNTERVEVL KGPAAVLYGR GSTGGIVNRV SKKPQKGLES SVSAQVGSFD SRRLAADLNG       180
     EAGEQVQVRL NLAQEDKDSF RNGVTSKRTL LAPSVNWEIS DKLNWLVQYE RNEHDRTPDR       240
     GIPGVNGRPA DVPKEYVYSD TRRDFIDDVA QSTRSRLTWD INDQWQLRQQ LGYTSLDSQF       300
     DNTYVTSVKG DQVTRSRWQQ DLKANSLISN TEAEGQLQTG PVEHRLLVGF EQNWQERTPK       360
     LYQNATAIPA GNLYDPGSLP TYDGAMKLSS DANHKVRGYG LYVQDQLSLG DWHLLAGLRR       420
     DDFTVTSRRN DLNKEETVSV TSLSPRLGLV WNPIEEHAFY ASYSKTFTPV GGELIGITPG       480
     DKNNNLDPQH TRLYEGGVKS DWLDGRLATT LSLYRLEMYN KRSKDPLDPT KVILTGLQRT       540
     EGIELSARAQ LTDELYLRGG IAIQDAEQVK ADADLQGKRP MNVSRQNGEL FAGYQSGKQG       600
     WFGETGVTAV GDRFADNANT TTLPGYARFD ARAGYRWQQW ETQLSVENLT DHDYFVSATS       660
     ASQIMPGTPR QLHLSAAYRF                                                   680
//

If you have problems or comments...

PBIL Back to PBIL home page