(data stored in ACNUC7421 zone)

EMBL: CP000462.PE441

CP000462.PE441       Location/Qualifiers
FT   CDS             495522..495773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0465"
FT                   /product="proteinase inhibitor"
FT                   /note="identified by match to protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39082"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH2"
FT                   /protein_id="ABK39082.1"
FT                   /translation="MECRQGCGACCIAPSISSAIPGMPDGKPAGVPCVQLDARLGCKIF
FT                   GQPERPAVCGGFRPMQDVCGYHREEAIWLIGELERMTS"
     MECRQGCGAC CIAPSISSAI PGMPDGKPAG VPCVQLDARL GCKIFGQPER PAVCGGFRPM        60
     QDVCGYHREE AIWLIGELER MTS                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page