(data stored in ACNUC7421 zone)

EMBL: CP000462.PE442

CP000462.PE442       Location/Qualifiers
FT   CDS             complement(495930..497093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0466"
FT                   /product="HemY protein"
FT                   /note="identified by match to protein family HMM PF07219;
FT                   match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39531"
FT                   /db_xref="GOA:A0KFH3"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH3"
FT                   /protein_id="ABK39531.1"
FT                   /translation="MIRLIVLVAAMVAGLIFGPQASGNKGYVLISLGNYTVESSVTSAV
FT                   ILAVLFYGALLIVEWLLGRVFGLRRKTLGWYGSRRRRKANQQTVAATLAMAEGHYSQAE
FT                   KLMLKGASNSDTPLLNYLSAAKAAQARGDDVRRDQYLQKAQEENPKAELALTLTQTQLQ
FT                   IEQGQYDTALAMLESVYALNPRHPMVLDQLRQVHLAREDWAALIDLIPVLHKVGKLTPK
FT                   QEEDLLQQAWRGRLDAASGALETLRPIWQELPRKLRQDPDLLAAYGDRLRQLGADNEAA
FT                   ELWLDALRKQVSPQLLARLPKLKLDSYQPMLTLLQKIQDQPGVDAALAQVYLLAGQLDD
FT                   AQRLLEQEVAKAPNAAVYHALGQVMDKRRLTNKANEYYRQALQLADV"
     MIRLIVLVAA MVAGLIFGPQ ASGNKGYVLI SLGNYTVESS VTSAVILAVL FYGALLIVEW        60
     LLGRVFGLRR KTLGWYGSRR RRKANQQTVA ATLAMAEGHY SQAEKLMLKG ASNSDTPLLN       120
     YLSAAKAAQA RGDDVRRDQY LQKAQEENPK AELALTLTQT QLQIEQGQYD TALAMLESVY       180
     ALNPRHPMVL DQLRQVHLAR EDWAALIDLI PVLHKVGKLT PKQEEDLLQQ AWRGRLDAAS       240
     GALETLRPIW QELPRKLRQD PDLLAAYGDR LRQLGADNEA AELWLDALRK QVSPQLLARL       300
     PKLKLDSYQP MLTLLQKIQD QPGVDAALAQ VYLLAGQLDD AQRLLEQEVA KAPNAAVYHA       360
     LGQVMDKRRL TNKANEYYRQ ALQLADV                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page