(data stored in ACNUC7421 zone)

EMBL: CP000462.PE455

CP000462.PE455       Location/Qualifiers
FT   CDS             complement(509242..510768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0479"
FT                   /product="transporter, small conductance mechanosensitive
FT                   ion channel (MscS) family"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37369"
FT                   /db_xref="GOA:A0KFI6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI6"
FT                   /protein_id="ABK37369.1"
FT                   /translation="MFSDNLVALPTLLWIGEHPFWTLLTLFLLFTHFLRSPGRRRELVS
FT                   ELGFVMISLVVILLIQFEGGWFRLPLPHRWLVEISSLLAGLVLVKIWGILLFQFLLPLC
FT                   QIRIPRIIADIVITVGYIGWCLFRLYASGMALGEIVTTSAVITAVIAFSMQDTLGNLLA
FT                   GVSIQLDNSIAIGDWLQVETTQGRVVEINWRATTIETRNWETVVIPNSHLLKQRFTVLG
FT                   RRQNAPLQWRRWVWFDITLDTLPTQIIALVEQSLRETRIRHVSASPQPDCLLMNVENGI
FT                   ARYAVRYWLTDLAVDDPTDSAVRTLIDAALRRNDRRLTPPIFNVFMTTDQDHKDQRHKR
FT                   HTAERTDTLRRLPLFAMLQEEELLRLADQVKFAPFVNGDRMLSQGEVSGWLFVLVKGDA
FT                   QMLVEVEGRELPLGTLNAGDFFGELSLLTGEPSPFTVRALGTVETYRINQAMFQELVAQ
FT                   RGSLLEPLYKVLSARQQEQQELLAREAEAMKQITPPRDLLDKLMALFGGR"
     MFSDNLVALP TLLWIGEHPF WTLLTLFLLF THFLRSPGRR RELVSELGFV MISLVVILLI        60
     QFEGGWFRLP LPHRWLVEIS SLLAGLVLVK IWGILLFQFL LPLCQIRIPR IIADIVITVG       120
     YIGWCLFRLY ASGMALGEIV TTSAVITAVI AFSMQDTLGN LLAGVSIQLD NSIAIGDWLQ       180
     VETTQGRVVE INWRATTIET RNWETVVIPN SHLLKQRFTV LGRRQNAPLQ WRRWVWFDIT       240
     LDTLPTQIIA LVEQSLRETR IRHVSASPQP DCLLMNVENG IARYAVRYWL TDLAVDDPTD       300
     SAVRTLIDAA LRRNDRRLTP PIFNVFMTTD QDHKDQRHKR HTAERTDTLR RLPLFAMLQE       360
     EELLRLADQV KFAPFVNGDR MLSQGEVSGW LFVLVKGDAQ MLVEVEGREL PLGTLNAGDF       420
     FGELSLLTGE PSPFTVRALG TVETYRINQA MFQELVAQRG SLLEPLYKVL SARQQEQQEL       480
     LAREAEAMKQ ITPPRDLLDK LMALFGGR                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page