(data stored in ACNUC7421 zone)

EMBL: CP000462.PE456

CP000462.PE456       Location/Qualifiers
FT   CDS             510884..511297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0480"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36907"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI7"
FT                   /protein_id="ABK36907.1"
FT                   /translation="MRTLNKMVWIAGAWLLTGCDQLADKYRVEFRDGSWREIAITPFAD
FT                   EARWREGCATGEVLSDMMLPLKRGKTVNGREQLLIGGELFELDDSALYRSNGMVFGHTP
FT                   DHIQRGLKGLEVCRTLRPDRGALPKLKARGFGD"
     MRTLNKMVWI AGAWLLTGCD QLADKYRVEF RDGSWREIAI TPFADEARWR EGCATGEVLS        60
     DMMLPLKRGK TVNGREQLLI GGELFELDDS ALYRSNGMVF GHTPDHIQRG LKGLEVCRTL       120
     RPDRGALPKL KARGFGD                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page