(data stored in ACNUC7421 zone)

EMBL: CP000462.PE457

CP000462.PE457       Location/Qualifiers
FT   CDS             complement(511307..512077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0481"
FT                   /product="glutamine amidotransferase, class I"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF07722"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38360"
FT                   /db_xref="GOA:A0KFI8"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI8"
FT                   /protein_id="ABK38360.1"
FT                   /translation="MTRSPHTPRKPVVLMTTGAQPRNGHAYQVMTHKYIKPLVEISGCV
FT                   PLLVPTCCGTEDLAQYLDLADGVYLSGAGSNIDPALYGQENLTPEKQQDRDRDLFDIPL
FT                   VRAALDRGLPILGICRGMQEINVALGGDIHQKVYSEPGYDDHREDADDPVDDQYGESHQ
FT                   VELVPGSWLAELMGQPSIPVNSLHGQGIKTLAKGLEPLAHAEDGLIEAIHAPTLSPFLL
FT                   AVQWHPEWKASENPHSIKIFEAFGDACRARLSGL"
     MTRSPHTPRK PVVLMTTGAQ PRNGHAYQVM THKYIKPLVE ISGCVPLLVP TCCGTEDLAQ        60
     YLDLADGVYL SGAGSNIDPA LYGQENLTPE KQQDRDRDLF DIPLVRAALD RGLPILGICR       120
     GMQEINVALG GDIHQKVYSE PGYDDHREDA DDPVDDQYGE SHQVELVPGS WLAELMGQPS       180
     IPVNSLHGQG IKTLAKGLEP LAHAEDGLIE AIHAPTLSPF LLAVQWHPEW KASENPHSIK       240
     IFEAFGDACR ARLSGL                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page