(data stored in ACNUC7421 zone)

EMBL: CP000462.PE458

CP000462.PE458       Location/Qualifiers
FT   CDS             complement(512439..513248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0482"
FT                   /product="phosphatase YidA"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37698"
FT                   /db_xref="GOA:A0KFI9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI9"
FT                   /protein_id="ABK37698.1"
FT                   /translation="MYKLIALDMDGTLLNSQGQISPRTHAAIAAARAKGVTVVLASGRP
FT                   LEGMSRYLVELGLTGQDDYVICYNGALVQQVADQRIIRSQLLTGSDASAIAALADELGV
FT                   NVHGFSVSRGLISPRVSPYTEHESRLIDMPIKLLDFATLPADEQILKVMMIDPEPLLSP
FT                   AIAKLPAELYQRYTVVRSAPYFLEFMNKQSNKGTGVAALAEHLGLDASQVIAVGDAGND
FT                   HHMIEYAGLGVAMGNATDDIKALAQHTTGRNDEDGVAQVIERFILNA"
     MYKLIALDMD GTLLNSQGQI SPRTHAAIAA ARAKGVTVVL ASGRPLEGMS RYLVELGLTG        60
     QDDYVICYNG ALVQQVADQR IIRSQLLTGS DASAIAALAD ELGVNVHGFS VSRGLISPRV       120
     SPYTEHESRL IDMPIKLLDF ATLPADEQIL KVMMIDPEPL LSPAIAKLPA ELYQRYTVVR       180
     SAPYFLEFMN KQSNKGTGVA ALAEHLGLDA SQVIAVGDAG NDHHMIEYAG LGVAMGNATD       240
     DIKALAQHTT GRNDEDGVAQ VIERFILNA                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page