(data stored in ACNUC7421 zone)

EMBL: CP000462.PE459

CP000462.PE459       Location/Qualifiers
FT   CDS             complement(513353..515047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03961"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39247"
FT                   /db_xref="GOA:A0KFJ0"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ0"
FT                   /protein_id="ABK39247.1"
FT                   /translation="MRTKEGIRVLSKEWLLLSADMEYACLRIVPGLTNPISESDIQTLL
FT                   LASNCRRYQPLTEGIKQAISLLNTLLSNPTAPLPGNPVPIAQRHDASVLLVVEKDRMSA
FT                   TAQITADWGGKYLTSEQLEQAIQSSEISQGVQAPLIAAAVLAAKEATPGTLLRLPVAQG
FT                   KAAVNGQDTRFERLVETPAERILKPQELDHGRVDMRDLGTILTVKAGAQLMRRHPATQG
FT                   VPGFTVTGQELPAKHGKDSPMVAGEGTFLSPDDPDLLLASRPGLPRQEKNGMKVDDVLS
FT                   VKQVDIRHGHVIFEGALIVAGDVTPGMKIKTSGDVVIGGFVEGGYIESSGTITVRNGII
FT                   GRKSEQSDEFLCHLNAQGEIHASYAQYAKLEAGGDIHILTQLSHCYSRSGQDLKVGDSG
FT                   MRKGHLLGGISIANRLIMAPILGASAHNQTRLQILGGYFTHKEQEQALRQRKQECREQL
FT                   DKLQDLLLKLLQLPSDKRNPQTLQKIKLIRTQRLEESKLLDEQLEAAQEELQKLMAEMD
FT                   IIATQHAFPGVEVEMAHHHYRVDIEHGPIHFAIREDQLQLTPYEPHK"
     MRTKEGIRVL SKEWLLLSAD MEYACLRIVP GLTNPISESD IQTLLLASNC RRYQPLTEGI        60
     KQAISLLNTL LSNPTAPLPG NPVPIAQRHD ASVLLVVEKD RMSATAQITA DWGGKYLTSE       120
     QLEQAIQSSE ISQGVQAPLI AAAVLAAKEA TPGTLLRLPV AQGKAAVNGQ DTRFERLVET       180
     PAERILKPQE LDHGRVDMRD LGTILTVKAG AQLMRRHPAT QGVPGFTVTG QELPAKHGKD       240
     SPMVAGEGTF LSPDDPDLLL ASRPGLPRQE KNGMKVDDVL SVKQVDIRHG HVIFEGALIV       300
     AGDVTPGMKI KTSGDVVIGG FVEGGYIESS GTITVRNGII GRKSEQSDEF LCHLNAQGEI       360
     HASYAQYAKL EAGGDIHILT QLSHCYSRSG QDLKVGDSGM RKGHLLGGIS IANRLIMAPI       420
     LGASAHNQTR LQILGGYFTH KEQEQALRQR KQECREQLDK LQDLLLKLLQ LPSDKRNPQT       480
     LQKIKLIRTQ RLEESKLLDE QLEAAQEELQ KLMAEMDIIA TQHAFPGVEV EMAHHHYRVD       540
     IEHGPIHFAI REDQLQLTPY EPHK                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page