(data stored in ACNUC7421 zone)

EMBL: CP000462.PE463

CP000462.PE463       Location/Qualifiers
FT   CDS             complement(518484..519641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0487"
FT                   /product="competence/damage-inducible protein CinA"
FT                   /note="identified by match to protein family HMM PF00994"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37416"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ4"
FT                   /protein_id="ABK37416.1"
FT                   /translation="MRIEIISTGDEIVTGLVVDTNAAWLSALLLEQGWQVRRRVTVGDN
FT                   LKDLKTVLAESASRAEVVLVCGGLGPTADDLTAQAAAEAFDQPLTLFPDWLATIEARYA
FT                   SRGRPMPASNAKQAWLPQGGEILDNPVGTACGFVVTHTGHQGPSLLFFTPGVPFEFKQM
FT                   VREQIMPRLKALAGAQTDTELRRFYTFGVSESALSDMLDAAPWPAGIELGYRSSMPLIE
FT                   LKLIGHGASAADMDAAEARLLAAIEPWLVGRGDKEPAQQILDLLGDKPLTLLEGESRGA
FT                   LLAMCHPHPALTASFSHALASELAQLAAPAAPLSLTIGRAGPDGVPLLLCVDGQLYGQT
FT                   LKVSHPDPDSGRRIIAFAALDMLRRQLQGLPVLGDYRTLARTASR"
     MRIEIISTGD EIVTGLVVDT NAAWLSALLL EQGWQVRRRV TVGDNLKDLK TVLAESASRA        60
     EVVLVCGGLG PTADDLTAQA AAEAFDQPLT LFPDWLATIE ARYASRGRPM PASNAKQAWL       120
     PQGGEILDNP VGTACGFVVT HTGHQGPSLL FFTPGVPFEF KQMVREQIMP RLKALAGAQT       180
     DTELRRFYTF GVSESALSDM LDAAPWPAGI ELGYRSSMPL IELKLIGHGA SAADMDAAEA       240
     RLLAAIEPWL VGRGDKEPAQ QILDLLGDKP LTLLEGESRG ALLAMCHPHP ALTASFSHAL       300
     ASELAQLAAP AAPLSLTIGR AGPDGVPLLL CVDGQLYGQT LKVSHPDPDS GRRIIAFAAL       360
     DMLRRQLQGL PVLGDYRTLA RTASR                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page