(data stored in ACNUC7421 zone)

EMBL: CP000462.PE464

CP000462.PE464       Location/Qualifiers
FT   CDS             complement(519702..521000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0488"
FT                   /product="HD-GYP domain"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36755"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ5"
FT                   /protein_id="ABK36755.1"
FT                   /translation="MYSPPPLTSIRLSVSLASKTMTGIKISVDRLQVGNYVSLPLGWRE
FT                   HPFLFSSFKLKNEEEIELIRRLGLKLVTIIPDKSDAPPKPLNQIQAQPVEAPDTSQRQA
FT                   EMQLEKERRIEQLQQYRRDLQQCEKQFQQSLAQVRNVMSKIQSRPLNAIGEAQELINAM
FT                   TEQLLSVDEMVLHLVSDSEDGNNLYFHSLNVSVLSMLLAKECNMSADEIRQVGMGALFH
FT                   DIGKLKIPSQILRKTEPLTKPEQNLMAQHPRYGLDLLNLAKDFPAEAKGIVLHHHEYLD
FT                   GSGPEGLKKGQLDPLTQIVSLINEYDNLCHMQAKVPYSALSGLYKQRKAQFNPEYLSML
FT                   IRLMGIYPPGSVVQLSNGQVGLVMSVNASRLLYPSVLVYDPRIPRQEAAIIDLQQAELS
FT                   IAKVIHPKRLPPAVFEYLNPRTRISYYFEHTKP"
     MYSPPPLTSI RLSVSLASKT MTGIKISVDR LQVGNYVSLP LGWREHPFLF SSFKLKNEEE        60
     IELIRRLGLK LVTIIPDKSD APPKPLNQIQ AQPVEAPDTS QRQAEMQLEK ERRIEQLQQY       120
     RRDLQQCEKQ FQQSLAQVRN VMSKIQSRPL NAIGEAQELI NAMTEQLLSV DEMVLHLVSD       180
     SEDGNNLYFH SLNVSVLSML LAKECNMSAD EIRQVGMGAL FHDIGKLKIP SQILRKTEPL       240
     TKPEQNLMAQ HPRYGLDLLN LAKDFPAEAK GIVLHHHEYL DGSGPEGLKK GQLDPLTQIV       300
     SLINEYDNLC HMQAKVPYSA LSGLYKQRKA QFNPEYLSML IRLMGIYPPG SVVQLSNGQV       360
     GLVMSVNASR LLYPSVLVYD PRIPRQEAAI IDLQQAELSI AKVIHPKRLP PAVFEYLNPR       420
     TRISYYFEHT KP                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page