(data stored in ACNUC7421 zone)

EMBL: CP000462.PE466

CP000462.PE466       Location/Qualifiers
FT   CDS             complement(522047..522619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0490"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39697"
FT                   /db_xref="GOA:A0KFJ7"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR022778"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ7"
FT                   /protein_id="ABK39697.1"
FT                   /translation="MAHSKTGSSPACLAIAGVIRIFMHPSHPFWSQEVPRVDGQLLLTP
FT                   CPGTQQVALPLALGQLKLAGAHGVLTLMTDAELARLELGRLGQQIEAAGMRWFQLPIED
FT                   DQAPDAAFEAAWQQTLPDLIGLLRDGKHLVIHCKGGSGRTGLVAAALLMSLGQPQQEAM
FT                   AAIRAHRPKAFTLACHRQWLDGLAEGD"
     MAHSKTGSSP ACLAIAGVIR IFMHPSHPFW SQEVPRVDGQ LLLTPCPGTQ QVALPLALGQ        60
     LKLAGAHGVL TLMTDAELAR LELGRLGQQI EAAGMRWFQL PIEDDQAPDA AFEAAWQQTL       120
     PDLIGLLRDG KHLVIHCKGG SGRTGLVAAA LLMSLGQPQQ EAMAAIRAHR PKAFTLACHR       180
     QWLDGLAEGD                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page