(data stored in ACNUC7421 zone)

EMBL: CP000462.PE468

CP000462.PE468       Location/Qualifiers
FT   CDS             complement(523241..525205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0492"
FT                   /product="sulfatase"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38012"
FT                   /db_xref="GOA:A0KFJ9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ9"
FT                   /protein_id="ABK38012.1"
FT                   /translation="MTTIRRWLGPFWPIAVFSLIALVSLSISRLALGLWQLERVDAVAG
FT                   WQEMLLQGLRVDFATLCWLWGVPAVFTLLLAGPHAVGRAWLQFIRVWLTLGLWLLLFLE
FT                   ISTPSFVTEYGVRPNRLYIEYLIYPKEVFAMLWAGRKGELLLALLFSGAVLAGGWWLSG
FT                   RLLRGISFPRWYWRPAFALLILAIGFLGARSSLGHRALNPAMVAFASDPLVNALTVNSS
FT                   YSLFFAIKQMRAEEDASQFYGELPRQRILDLVRQESGRESHEFSSDTLPSQTFNEASYG
FT                   GKPKNLVILLQESLGAQFVGSLGGLPLTPNIDALSKEGWAFEQLYATGTRSVRGIEAVL
FT                   TGFTPTPAQAVVKLGRSQTNFFTIADLLKQRGYDTSFIYGGESHFDNMRSFFLGNGFTT
FT                   IVEQKDFKNPVFEGSWGASDEDLMAKADETFQALSKQGKPFFSLVFSSSNHDPFEFPDD
FT                   RIALYEQPKQTRNNAAKYADYAIGEFFKKAKQSDYWKDTLFLVIADHDSRVSGASLVPI
FT                   PRFHIPGVIVGDGIAPRQDPRIVSQIDMAPTLLSLMGISADYPMLGKDLTRMPADWPGR
FT                   AIMQYDKNFALMRGKDVVILQPERAPEGFIYEDATETLTPAPQPATMKDAALGLALWGS
FT                   LAYQQGLYRTAPDTRTVLN"
     MTTIRRWLGP FWPIAVFSLI ALVSLSISRL ALGLWQLERV DAVAGWQEML LQGLRVDFAT        60
     LCWLWGVPAV FTLLLAGPHA VGRAWLQFIR VWLTLGLWLL LFLEISTPSF VTEYGVRPNR       120
     LYIEYLIYPK EVFAMLWAGR KGELLLALLF SGAVLAGGWW LSGRLLRGIS FPRWYWRPAF       180
     ALLILAIGFL GARSSLGHRA LNPAMVAFAS DPLVNALTVN SSYSLFFAIK QMRAEEDASQ       240
     FYGELPRQRI LDLVRQESGR ESHEFSSDTL PSQTFNEASY GGKPKNLVIL LQESLGAQFV       300
     GSLGGLPLTP NIDALSKEGW AFEQLYATGT RSVRGIEAVL TGFTPTPAQA VVKLGRSQTN       360
     FFTIADLLKQ RGYDTSFIYG GESHFDNMRS FFLGNGFTTI VEQKDFKNPV FEGSWGASDE       420
     DLMAKADETF QALSKQGKPF FSLVFSSSNH DPFEFPDDRI ALYEQPKQTR NNAAKYADYA       480
     IGEFFKKAKQ SDYWKDTLFL VIADHDSRVS GASLVPIPRF HIPGVIVGDG IAPRQDPRIV       540
     SQIDMAPTLL SLMGISADYP MLGKDLTRMP ADWPGRAIMQ YDKNFALMRG KDVVILQPER       600
     APEGFIYEDA TETLTPAPQP ATMKDAALGL ALWGSLAYQQ GLYRTAPDTR TVLN             654
//

If you have problems or comments...

PBIL Back to PBIL home page