(data stored in ACNUC7421 zone)

EMBL: CP000462.PE47

CP000462.PE47        Location/Qualifiers
FT   CDS             complement(53349..53783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0051"
FT                   /product="universal stress protein A"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35943"
FT                   /db_xref="GOA:A0KR05"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR05"
FT                   /protein_id="ABK35943.1"
FT                   /translation="MNGTYYKHILAAIDLSEDNRKVIEKAVDRARSNGAKLSVIHVDVD
FT                   LKDLYTEMIDIDIDNVQDQVIAEAKEKLEAFLASVDYPIEKKLVICGDLSERVNQAVRD
FT                   YQIDLLVCGHRQSFWSLLTSSARQLMNTVPCDLLVVPLQK"
     MNGTYYKHIL AAIDLSEDNR KVIEKAVDRA RSNGAKLSVI HVDVDLKDLY TEMIDIDIDN        60
     VQDQVIAEAK EKLEAFLASV DYPIEKKLVI CGDLSERVNQ AVRDYQIDLL VCGHRQSFWS       120
     LLTSSARQLM NTVPCDLLVV PLQK                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page