(data stored in ACNUC7421 zone)

EMBL: CP000462.PE471

CP000462.PE471       Location/Qualifiers
FT   CDS             528005..529678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0495"
FT                   /product="glycosidase"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38833"
FT                   /db_xref="GOA:A0KFK2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK2"
FT                   /protein_id="ABK38833.1"
FT                   /translation="MAPVWRFGRRYHHSGNITMKQGTLRHGGLIGAALLLTACGSGGGS
FT                   GSSEPQQPPVTNPPPATASRACYGNDQPACNLRTYQVMVESFVDGDGSANYGVGYGPSQ
FT                   HNGDLQGIIDSLDHIKSLNVNAIWLTPVFDSCAGQGGDDKLDATGYFACDFFNVDPNFG
FT                   SNVQLKQLVDGAHQRGLYVFLDGVFGHVNKVGVSKPSPEGRLPALKSGGAGYPGQLVDY
FT                   SQPQSLAYFKEVARYWVEQYGIDGWRLDQAYQLGLDDWRAIRSEVERASAARKTAGQQW
FT                   GTLGYMVGEVWKGADEIRAQAYGPSDNPALSSAFDFPLRYGLVQALAVEESGKGGQGAS
FT                   VLDASWNKVENYPNHAMPNLMLGNHDLVRFGDLLERGNFNPADYWQRHKAAFSFLAARS
FT                   GPITLYYGEEFGDEVPGFAKQVGGDCAAQGLCDDHVARSDGKVPGATGFVPSSEQSELK
FT                   QWLSQLLALRAAHPALYQGERVKLVAEGSVYGDIKQTAAEQVVYLLNVSSTPQSYAVPV
FT                   GKLRSASALVDLQSGESLAIGGSSVTVDLPPLSGRFLLVR"
     MAPVWRFGRR YHHSGNITMK QGTLRHGGLI GAALLLTACG SGGGSGSSEP QQPPVTNPPP        60
     ATASRACYGN DQPACNLRTY QVMVESFVDG DGSANYGVGY GPSQHNGDLQ GIIDSLDHIK       120
     SLNVNAIWLT PVFDSCAGQG GDDKLDATGY FACDFFNVDP NFGSNVQLKQ LVDGAHQRGL       180
     YVFLDGVFGH VNKVGVSKPS PEGRLPALKS GGAGYPGQLV DYSQPQSLAY FKEVARYWVE       240
     QYGIDGWRLD QAYQLGLDDW RAIRSEVERA SAARKTAGQQ WGTLGYMVGE VWKGADEIRA       300
     QAYGPSDNPA LSSAFDFPLR YGLVQALAVE ESGKGGQGAS VLDASWNKVE NYPNHAMPNL       360
     MLGNHDLVRF GDLLERGNFN PADYWQRHKA AFSFLAARSG PITLYYGEEF GDEVPGFAKQ       420
     VGGDCAAQGL CDDHVARSDG KVPGATGFVP SSEQSELKQW LSQLLALRAA HPALYQGERV       480
     KLVAEGSVYG DIKQTAAEQV VYLLNVSSTP QSYAVPVGKL RSASALVDLQ SGESLAIGGS       540
     SVTVDLPPLS GRFLLVR                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page