(data stored in ACNUC7421 zone)

EMBL: CP000462.PE472

CP000462.PE472       Location/Qualifiers
FT   CDS             complement(529733..530263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0496"
FT                   /product="putative transporter, putative Mg2+ transporter-C
FT                   (MgtC) family"
FT                   /note="identified by match to protein family HMM PF02308"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37155"
FT                   /db_xref="GOA:A0KFK3"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK3"
FT                   /protein_id="ABK37155.1"
FT                   /translation="MTTDWWDIAPLGWENILVCLVCGTLVGLERQLRGKPVGIRTSSLI
FT                   ILGTYCFLAIGAAVSPQSADQARVLGQLITGIGFLGAGVMMTRDGQVLGVTSAATVWML
FT                   AALGALIGMQMLHQALLLTGVTLSILVGVDYLETSFKSLRRGVHNRLESWRHGNGNVQA
FT                   APHQDELGSGIEK"
     MTTDWWDIAP LGWENILVCL VCGTLVGLER QLRGKPVGIR TSSLIILGTY CFLAIGAAVS        60
     PQSADQARVL GQLITGIGFL GAGVMMTRDG QVLGVTSAAT VWMLAALGAL IGMQMLHQAL       120
     LLTGVTLSIL VGVDYLETSF KSLRRGVHNR LESWRHGNGN VQAAPHQDEL GSGIEK           176
//

If you have problems or comments...

PBIL Back to PBIL home page