(data stored in ACNUC7421 zone)

EMBL: CP000462.PE476

CP000462.PE476       Location/Qualifiers
FT   CDS             532695..533441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0500"
FT                   /product="NADP-dependent l-serine/l-allo-threonine
FT                   dehydrogenase ydfg"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35974"
FT                   /db_xref="GOA:A0KFK7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK7"
FT                   /protein_id="ABK35974.1"
FT                   /translation="MIAMVTGASSGFGESISRQLVQAGYRVIGTGRRGERLAALADELG
FT                   AQFLPLVFDVQDKAATRAAIDGLPAEWREVDLLVNNAGLALGLEPAHKADLEDWEQMIA
FT                   TNISGLTLLTRLLLPGMVARNRGHVINIGSIAGTYPYPGGNVYGATKAFVKQFSLNLRA
FT                   DLAGTAIRVTNVEPGLCGGTEFSNVRFHGDDAKAATVYQGVQAIQPEDIANTVLWISQQ
FT                   PAHVNINSIEIMPVAQTFGPLNISRR"
     MIAMVTGASS GFGESISRQL VQAGYRVIGT GRRGERLAAL ADELGAQFLP LVFDVQDKAA        60
     TRAAIDGLPA EWREVDLLVN NAGLALGLEP AHKADLEDWE QMIATNISGL TLLTRLLLPG       120
     MVARNRGHVI NIGSIAGTYP YPGGNVYGAT KAFVKQFSLN LRADLAGTAI RVTNVEPGLC       180
     GGTEFSNVRF HGDDAKAATV YQGVQAIQPE DIANTVLWIS QQPAHVNINS IEIMPVAQTF       240
     GPLNISRR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page