(data stored in ACNUC7421 zone)

EMBL: CP000462.PE479

CP000462.PE479       Location/Qualifiers
FT   CDS             complement(536092..536673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38071"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL0"
FT                   /protein_id="ABK38071.1"
FT                   /translation="MKLKHAWIAGLLSLSTCLAQAAEVATEVATAPGKANLVEAVSAQA
FT                   TVTAIDMASRKVSLKNAAGEAFDIVAGEQVTNLANLKVGDVVALRYLQMLDLELLKGTA
FT                   GVRKRIVEVAAGKAEAGEKPGAGIGKKVTLYGDVIAVDKGQQTITVKGVDHTLVLKVHN
FT                   PAQFALIAKGDQIKAVQTQAVGIGILPEKK"
     MKLKHAWIAG LLSLSTCLAQ AAEVATEVAT APGKANLVEA VSAQATVTAI DMASRKVSLK        60
     NAAGEAFDIV AGEQVTNLAN LKVGDVVALR YLQMLDLELL KGTAGVRKRI VEVAAGKAEA       120
     GEKPGAGIGK KVTLYGDVIA VDKGQQTITV KGVDHTLVLK VHNPAQFALI AKGDQIKAVQ       180
     TQAVGIGILP EKK                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page