(data stored in ACNUC7421 zone)

EMBL: CP000462.PE482

CP000462.PE482       Location/Qualifiers
FT   CDS             complement(539003..540271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0506"
FT                   /product="O-acetylhomoserine sulfhydrylase MetY"
FT                   /EC_number="2.5.1.49"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01053; match to protein
FT                   family HMM PF01212; match to protein family HMM TIGR01326"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37755"
FT                   /db_xref="GOA:A0KFL3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL3"
FT                   /protein_id="ABK37755.1"
FT                   /translation="MKDATLALHHGFTSDPTTKAVAVPIYQTVAYEFESAQHGADLFNL
FT                   AVPGNIYTRIMNPTNDVLEQRMAALEGGIAGLVVSAGSAAITYAIQALTAAGDNIVSTP
FT                   QLYGGTYTLFAHMLPSFGVEVRFAKDDSAEAIAALIDDKTKAVYCESIGNPAGNIVDLA
FT                   AFAKVAHARGVPLIVDNTVATPVLCKPIEHGADIVVHSLTKYVGGHGNSLGGVIVDSGK
FT                   FPWADHAERFPQLTKPEPSYHGVVYTEAFGPAAFIGRVRTVPLRNTGAALAPMNAFLLL
FT                   QGLETLSLRMERHVDNALRVAHHLKHHPKVAWVSYAGLPGHPHYLLAEKYMAGRPSAIL
FT                   SFGLKDGYEAGVRFYDALKIFKRLVNIGDAKSLACHPASTTHRQLSEAEQAKAGVKPEM
FT                   IRLSVGIEAIEDILADLDQALEA"
     MKDATLALHH GFTSDPTTKA VAVPIYQTVA YEFESAQHGA DLFNLAVPGN IYTRIMNPTN        60
     DVLEQRMAAL EGGIAGLVVS AGSAAITYAI QALTAAGDNI VSTPQLYGGT YTLFAHMLPS       120
     FGVEVRFAKD DSAEAIAALI DDKTKAVYCE SIGNPAGNIV DLAAFAKVAH ARGVPLIVDN       180
     TVATPVLCKP IEHGADIVVH SLTKYVGGHG NSLGGVIVDS GKFPWADHAE RFPQLTKPEP       240
     SYHGVVYTEA FGPAAFIGRV RTVPLRNTGA ALAPMNAFLL LQGLETLSLR MERHVDNALR       300
     VAHHLKHHPK VAWVSYAGLP GHPHYLLAEK YMAGRPSAIL SFGLKDGYEA GVRFYDALKI       360
     FKRLVNIGDA KSLACHPAST THRQLSEAEQ AKAGVKPEMI RLSVGIEAIE DILADLDQAL       420
     EA                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page