(data stored in ACNUC7421 zone)

EMBL: CP000462.PE485

CP000462.PE485       Location/Qualifiers
FT   CDS             542474..542869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0509"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37087"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL6"
FT                   /protein_id="ABK37087.1"
FT                   /translation="MLEMQIQPRFQETDALGHINNTVPAVWFESARDPLFRIFSPELDV
FT                   HNWHLIIAGYTVQFKRELFYGQQVLIKTGVRRIGSSSFTLWQEAWQGDELAVTAETTLI
FT                   HFDYQSRQSIPLSDRHREGLRAWLIES"
     MLEMQIQPRF QETDALGHIN NTVPAVWFES ARDPLFRIFS PELDVHNWHL IIAGYTVQFK        60
     RELFYGQQVL IKTGVRRIGS SSFTLWQEAW QGDELAVTAE TTLIHFDYQS RQSIPLSDRH       120
     REGLRAWLIE S                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page