(data stored in ACNUC7421 zone)

EMBL: CP000462.PE486

CP000462.PE486       Location/Qualifiers
FT   CDS             542901..543614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0510"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36351"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL7"
FT                   /protein_id="ABK36351.1"
FT                   /translation="MRNTVIALSLGLGLGLCSLPSVAASLAEQFSLMEKGAESALDTRL
FT                   FSHDGVDIKAWVDGAPVIIAVPIMNEQGKLEGESRYYFKGGKLFGVKEPAAQFAFDDGG
FT                   KLTQWLDEKGQPAEFVSKMSMQQREVWLTKRAAELGKLFAQSPAEQKAAKGGVKLKGAE
FT                   LAHWLCNGKLMALAGGDKVTFEQAKLKTRAEGIEGEVSLRQEKGWQDLSLKCEVQGSQV
FT                   TRLTWQPLPGANKPQ"
     MRNTVIALSL GLGLGLCSLP SVAASLAEQF SLMEKGAESA LDTRLFSHDG VDIKAWVDGA        60
     PVIIAVPIMN EQGKLEGESR YYFKGGKLFG VKEPAAQFAF DDGGKLTQWL DEKGQPAEFV       120
     SKMSMQQREV WLTKRAAELG KLFAQSPAEQ KAAKGGVKLK GAELAHWLCN GKLMALAGGD       180
     KVTFEQAKLK TRAEGIEGEV SLRQEKGWQD LSLKCEVQGS QVTRLTWQPL PGANKPQ          237
//

If you have problems or comments...

PBIL Back to PBIL home page