(data stored in ACNUC7421 zone)

EMBL: CP000462.PE492

CP000462.PE492       Location/Qualifiers
FT   CDS             complement(546736..547761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0516"
FT                   /product="sanA protein"
FT                   /note="identified by match to protein family HMM PF02698"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36644"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM3"
FT                   /protein_id="ABK36644.1"
FT                   /translation="MTLCHLLLQTRTAPRMKKFAKILLACLCLLLASVATLLGYSEWTV
FT                   SDARHYTYDDVNAVPYNRVALVLGTSKYLIGGSPNHYFKYRIKAAAELYNNGKVDYILV
FT                   SGDNATVQYNEPRQMRRALIQAGIPANAIYSDYAGFRTLDSIVRAKEVFGQAHFTVVSQ
FT                   AFHNERAIFIARHFGIEAVGFNAVDPSAYQGIKTRVREVFARLMGLLDLYVLDKGPKFL
FT                   GEPIVIGGPVPCQALSTIGASQPCLPIAPPPHKPKAKPAAAVSAATATSAAAATSGAVA
FT                   TSAAVPNEAAPVDNPAAASAATPAGNIPATNTAVPSEVTPVDNPAAASAAPPTSSALTP
FT                   Q"
     MTLCHLLLQT RTAPRMKKFA KILLACLCLL LASVATLLGY SEWTVSDARH YTYDDVNAVP        60
     YNRVALVLGT SKYLIGGSPN HYFKYRIKAA AELYNNGKVD YILVSGDNAT VQYNEPRQMR       120
     RALIQAGIPA NAIYSDYAGF RTLDSIVRAK EVFGQAHFTV VSQAFHNERA IFIARHFGIE       180
     AVGFNAVDPS AYQGIKTRVR EVFARLMGLL DLYVLDKGPK FLGEPIVIGG PVPCQALSTI       240
     GASQPCLPIA PPPHKPKAKP AAAVSAATAT SAAAATSGAV ATSAAVPNEA APVDNPAAAS       300
     AATPAGNIPA TNTAVPSEVT PVDNPAAASA APPTSSALTP Q                           341
//

If you have problems or comments...

PBIL Back to PBIL home page