(data stored in ACNUC7421 zone)

EMBL: CP000462.PE494

CP000462.PE494       Location/Qualifiers
FT   CDS             complement(551179..551550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0518"
FT                   /product="putative fimbrial protein"
FT                   /note="identified by similarity to GB:CAA54702.1"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37893"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM5"
FT                   /protein_id="ABK37893.1"
FT                   /translation="MRCPFRTTTCDEKDIKMNTSTASVRNSAIRFASSAAAAMLLGAAL
FT                   LPATASAADGTITFTGTIYEAPCDFADNSVTCYSGTQRQTLDLASLQQAGSLNTISSTM
FT                   QYKLSAGSSNMAIVTVSYL"
     MRCPFRTTTC DEKDIKMNTS TASVRNSAIR FASSAAAAML LGAALLPATA SAADGTITFT        60
     GTIYEAPCDF ADNSVTCYSG TQRQTLDLAS LQQAGSLNTI SSTMQYKLSA GSSNMAIVTV       120
     SYL                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page