(data stored in ACNUC7421 zone)

EMBL: CP000462.PE497

CP000462.PE497       Location/Qualifiers
FT   CDS             553888..556422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0521"
FT                   /product="outer membrane usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39706"
FT                   /db_xref="GOA:A0KFM8"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM8"
FT                   /protein_id="ABK39706.1"
FT                   /translation="MSVSTSDSVRKKHYSKMVFMLCVPGLMAVANHAWAETEFNIDALD
FT                   LDERTKIDLSQFADEGYILPGDYYLEIEVNKNKLPLQKIPFYETDTGKGKGGVACLPQE
FT                   VIPKLALTDEAIAKIDTWHDGQCANLLALDGVVIANDIGNGLLRIAVPQAWMKYSDPNW
FT                   IPPEQWDEGIPGMMLDYNINAQVNEGDGYSNRNISSYGTLGFNYGAWRLRGDYQANAYW
FT                   GDNERTTSELNRIYAYRPLPDMAAKLTVGEQQLNSQLIDGFRYTGVNLANDERMLPPSL
FT                   QGYAPEVSGIAKTNAKVTISQSGRILYETNVPAGPFRIQGLDSSVRGRLDVRVEEQDGS
FT                   VNSFQVDTATVPYLTRPGYVRYNLAVGAPSEQTDSVHDVHGPAFVTGDFSWGVANSWSL
FT                   YGGSLVAGEYNSMGLGIGRDLYAFGAISADLTQSIAKLPGLSTKIGQSVRVNYAKQFDE
FT                   YNSSITFAGYRFSQHNFMTMSQFLSNKERLEKNETTSSDDYNTWGDKELYTITANKTFW
FT                   AEDAAKALTVYLDYTHRTYWEHDAEDRYGLTINKNVNIGSFKDVSVYVSAYKTKTENYE
FT                   DDKSVMLTLSMPIGDRKSAGYSVQSSNGKVTHLATYQDYSRPDDTYQLGAGVQSNGHAV
FT                   ARGYYNHNSDIGAVSLNAYSVQSEYTSVGASLRGGLTATQHGAALHQATRRGGTRMMVD
FT                   TDKTSGVSFNNGRAVTNRFGVAVISDMTDYRKSDTRVDVDQLSDDIDAMNAIKQGTLTE
FT                   GAIGYNAFEMAEGFKLLANVKLPDGSVPPFGATVVKDSGRVLSVVDEDGLVYLTGVKPN
FT                   EAFELSWGGARQCKIVAPQQVTDLSMKTLTCK"
     MSVSTSDSVR KKHYSKMVFM LCVPGLMAVA NHAWAETEFN IDALDLDERT KIDLSQFADE        60
     GYILPGDYYL EIEVNKNKLP LQKIPFYETD TGKGKGGVAC LPQEVIPKLA LTDEAIAKID       120
     TWHDGQCANL LALDGVVIAN DIGNGLLRIA VPQAWMKYSD PNWIPPEQWD EGIPGMMLDY       180
     NINAQVNEGD GYSNRNISSY GTLGFNYGAW RLRGDYQANA YWGDNERTTS ELNRIYAYRP       240
     LPDMAAKLTV GEQQLNSQLI DGFRYTGVNL ANDERMLPPS LQGYAPEVSG IAKTNAKVTI       300
     SQSGRILYET NVPAGPFRIQ GLDSSVRGRL DVRVEEQDGS VNSFQVDTAT VPYLTRPGYV       360
     RYNLAVGAPS EQTDSVHDVH GPAFVTGDFS WGVANSWSLY GGSLVAGEYN SMGLGIGRDL       420
     YAFGAISADL TQSIAKLPGL STKIGQSVRV NYAKQFDEYN SSITFAGYRF SQHNFMTMSQ       480
     FLSNKERLEK NETTSSDDYN TWGDKELYTI TANKTFWAED AAKALTVYLD YTHRTYWEHD       540
     AEDRYGLTIN KNVNIGSFKD VSVYVSAYKT KTENYEDDKS VMLTLSMPIG DRKSAGYSVQ       600
     SSNGKVTHLA TYQDYSRPDD TYQLGAGVQS NGHAVARGYY NHNSDIGAVS LNAYSVQSEY       660
     TSVGASLRGG LTATQHGAAL HQATRRGGTR MMVDTDKTSG VSFNNGRAVT NRFGVAVISD       720
     MTDYRKSDTR VDVDQLSDDI DAMNAIKQGT LTEGAIGYNA FEMAEGFKLL ANVKLPDGSV       780
     PPFGATVVKD SGRVLSVVDE DGLVYLTGVK PNEAFELSWG GARQCKIVAP QQVTDLSMKT       840
     LTCK                                                                    844
//

If you have problems or comments...

PBIL Back to PBIL home page