(data stored in ACNUC7421 zone)

EMBL: CP000462.PE5

CP000462.PE5         Location/Qualifiers
FT   CDS             complement(6409..6786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0005"
FT                   /product="glyoxalase family protein superfamily"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38384"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR026275"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF0"
FT                   /protein_id="ABK38384.1"
FT                   /translation="MLVPQFTILYVANPARSTLFYRELFGRPPVEESPTFAMFVFESGA
FT                   RLALWSSATVEPAVTQTAGAMELAFALPNDTAVDRQSAEWQARGLTLIQAPTRMEFGYT
FT                   CMALDPDGHRLRLYCPAPELG"
     MLVPQFTILY VANPARSTLF YRELFGRPPV EESPTFAMFV FESGARLALW SSATVEPAVT        60
     QTAGAMELAF ALPNDTAVDR QSAEWQARGL TLIQAPTRME FGYTCMALDP DGHRLRLYCP       120
     APELG                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page