(data stored in ACNUC7421 zone)

EMBL: CP000462.PE50

CP000462.PE50        Location/Qualifiers
FT   CDS             57348..57977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0054"
FT                   /product="ferritin"
FT                   /note="identified by match to protein family HMM PF00210"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37728"
FT                   /db_xref="GOA:A0KEB9"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB9"
FT                   /protein_id="ABK37728.1"
FT                   /translation="MRRKAVTTESSGSGIWLLHNETVATIVTKSQWRIIMLAKAMIEKL
FT                   NEQINLEFYSSNLYLQMSAWCEDKGFEGAANFLRQHAVEERQHMERLFTYVSETGAMPL
FT                   LGAIDAPPHEFKSLGDIFRTTLEHEYHITKCINGLAHVAFTTQDYSTFNFLQWYVAEQH
FT                   EEEKLFKSIVDRLSLVGEDGKGLYFIDKELAELAKGAPASIMDGNA"
     MRRKAVTTES SGSGIWLLHN ETVATIVTKS QWRIIMLAKA MIEKLNEQIN LEFYSSNLYL        60
     QMSAWCEDKG FEGAANFLRQ HAVEERQHME RLFTYVSETG AMPLLGAIDA PPHEFKSLGD       120
     IFRTTLEHEY HITKCINGLA HVAFTTQDYS TFNFLQWYVA EQHEEEKLFK SIVDRLSLVG       180
     EDGKGLYFID KELAELAKGA PASIMDGNA                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page