(data stored in ACNUC7421 zone)

EMBL: CP000462.PE500

CP000462.PE500       Location/Qualifiers
FT   CDS             558215..558766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0524"
FT                   /product="fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36075"
FT                   /db_xref="GOA:A0KFN1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN1"
FT                   /protein_id="ABK36075.1"
FT                   /translation="MLRTLLISLMLSPLIAVAAIPRAGDGLELRGDKLNLHGRIIDQPC
FT                   VVAPESLEQEVEMGVVDVKQLYANGAGEQVPFSIRLTNCKPGIFRMAKVTFTGSKDAQL
FT                   SGGLAFTAGIAKGAGIRLYDVTQTPLDLGTPSRGYLLGGSADNELQFFARVEGHPDALA
FT                   AKNIQPGDYSAVANFIVAYE"
     MLRTLLISLM LSPLIAVAAI PRAGDGLELR GDKLNLHGRI IDQPCVVAPE SLEQEVEMGV        60
     VDVKQLYANG AGEQVPFSIR LTNCKPGIFR MAKVTFTGSK DAQLSGGLAF TAGIAKGAGI       120
     RLYDVTQTPL DLGTPSRGYL LGGSADNELQ FFARVEGHPD ALAAKNIQPG DYSAVANFIV       180
     AYE                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page