(data stored in ACNUC7421 zone)

EMBL: CP000462.PE501

CP000462.PE501       Location/Qualifiers
FT   CDS             complement(558769..559452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37919"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN2"
FT                   /protein_id="ABK37919.1"
FT                   /translation="MTSETEKALNVKIDSLIPLIQRISRKADEQVSILVGKEAISYFSI
FT                   DNNSRKLSENVFLLRSGHPVAEEVQCVITTMTQQGDNVSHNYYNNPDTTVRYHSNCQAP
FT                   DNWVEMTRKSKFIVTMNREIVVATVIATDNQGKTLFNLDSVGDLERDDGDISVEVKNTI
FT                   VNFIDQQALTSNGMVATLVAALTPPKQTAQFVQLPGGIYLSNYLGGVITWPSLGNSKVI
FT                   QRNDL"
     MTSETEKALN VKIDSLIPLI QRISRKADEQ VSILVGKEAI SYFSIDNNSR KLSENVFLLR        60
     SGHPVAEEVQ CVITTMTQQG DNVSHNYYNN PDTTVRYHSN CQAPDNWVEM TRKSKFIVTM       120
     NREIVVATVI ATDNQGKTLF NLDSVGDLER DDGDISVEVK NTIVNFIDQQ ALTSNGMVAT       180
     LVAALTPPKQ TAQFVQLPGG IYLSNYLGGV ITWPSLGNSK VIQRNDL                     227
//

If you have problems or comments...

PBIL Back to PBIL home page