(data stored in ACNUC7421 zone)

EMBL: CP000462.PE506

CP000462.PE506       Location/Qualifiers
FT   CDS             complement(563510..564280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0530"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38232"
FT                   /db_xref="GOA:A0KFN7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN7"
FT                   /protein_id="ABK38232.1"
FT                   /translation="MAASADQPTLVLLHGLLGDAHDWQPVQAALAGLPSLALDLPGHGS
FT                   NRAVRVAGFEQAHRWLCDELAARDIDRYQLVGYSLGGRLALYHASQSLVGLQALLLENC
FT                   HPGLPPAERPARLAHDEGWARRFEQEPLAAVLADWYRQGVFADLGEDARARQIARRLGN
FT                   DGEAVAAMLRATSLGQQPNLGPWLAQGALPVTWVSGKRDHKFHQLACLMASQHRKINHL
FT                   ELDGGHNLHAHQPETFARLLAEWVNQQQEEKRHD"
     MAASADQPTL VLLHGLLGDA HDWQPVQAAL AGLPSLALDL PGHGSNRAVR VAGFEQAHRW        60
     LCDELAARDI DRYQLVGYSL GGRLALYHAS QSLVGLQALL LENCHPGLPP AERPARLAHD       120
     EGWARRFEQE PLAAVLADWY RQGVFADLGE DARARQIARR LGNDGEAVAA MLRATSLGQQ       180
     PNLGPWLAQG ALPVTWVSGK RDHKFHQLAC LMASQHRKIN HLELDGGHNL HAHQPETFAR       240
     LLAEWVNQQQ EEKRHD                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page