(data stored in ACNUC7421 zone)

EMBL: CP000462.PE514

CP000462.PE514       Location/Qualifiers
FT   CDS             complement(571508..572884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0538"
FT                   /product="ATP-independent RNA helicase DbpA"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF03880"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36285"
FT                   /db_xref="GOA:A0KFP5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP5"
FT                   /protein_id="ABK36285.1"
FT                   /translation="MNNEFSSLNLSPALQDNLASLGYLQMTPIQAQSLPLVLDGKDLIA
FT                   KAKTGSGKTAAFGLGLLANLDVNRLEVQALVLCPTRELADQVATEIRRLARTLPNVKLV
FT                   TLCGGTPTAPQSATLSFGAHIAVGTPGRILKHLEQGTLELDGLKTLVLDEADRMLDMGF
FT                   GEDINRVISHAPRDRQTLLFSATYPEGIAQMSRGVQRNPVEVSVESLHEDSAIEQKLYE
FT                   VPAGQRLDALGWLLSHYQPSSCVVFCNTKRACNDVADHLAAKGFSALALNGDLEQRERD
FT                   QVLVRFANGSATILVATDVAARGLDIKELGAVINYELTYDPEVHVHRIGRTGRAGQQGL
FT                   ALSLYQPNEAQRVNFIEEYQQAPIPQGDLAGIGRDIKPIAPQMVTLSIDAGRKSKVRAG
FT                   DILGALTGEGGIAGADVGKIQISEQYSYVAVKRQVASAALKRLQEGKIKGRSYRARKLG
FT                   "
     MNNEFSSLNL SPALQDNLAS LGYLQMTPIQ AQSLPLVLDG KDLIAKAKTG SGKTAAFGLG        60
     LLANLDVNRL EVQALVLCPT RELADQVATE IRRLARTLPN VKLVTLCGGT PTAPQSATLS       120
     FGAHIAVGTP GRILKHLEQG TLELDGLKTL VLDEADRMLD MGFGEDINRV ISHAPRDRQT       180
     LLFSATYPEG IAQMSRGVQR NPVEVSVESL HEDSAIEQKL YEVPAGQRLD ALGWLLSHYQ       240
     PSSCVVFCNT KRACNDVADH LAAKGFSALA LNGDLEQRER DQVLVRFANG SATILVATDV       300
     AARGLDIKEL GAVINYELTY DPEVHVHRIG RTGRAGQQGL ALSLYQPNEA QRVNFIEEYQ       360
     QAPIPQGDLA GIGRDIKPIA PQMVTLSIDA GRKSKVRAGD ILGALTGEGG IAGADVGKIQ       420
     ISEQYSYVAV KRQVASAALK RLQEGKIKGR SYRARKLG                               458
//

If you have problems or comments...

PBIL Back to PBIL home page