(data stored in ACNUC7421 zone)

EMBL: CP000462.PE515

CP000462.PE515       Location/Qualifiers
FT   CDS             573287..574654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0539"
FT                   /product="nucleoside permease NupC"
FT                   /note="identified by match to protein family HMM PF01773;
FT                   match to protein family HMM PF07662; match to protein
FT                   family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37802"
FT                   /db_xref="GOA:A0KFP6"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP6"
FT                   /protein_id="ABK37802.1"
FT                   /translation="MIRCLRERLINLKTFVLSNMHIFTADCDGYLIFKYANVYDGAGQK
FT                   ITNYSGATGMEYVHFVLGLVMVLALALLANRHNWKQIKLRYIGQLLVVELALAWFMLNS
FT                   EVGLAVVGGFAAGFTKLMEFAKQGTDFVFGGLVNEGAFSFFLMVLMPIVFISVLIGILQ
FT                   YIRLLPLVIRGIGTVLAKINGMGKLESFNAISSMIVGQSENFIALKNILPHLNEKQMYT
FT                   LAATAMSTVSMSIVGAYMQLIEPRYVVAALVLNMFSTFIVLSLINPYEPDNTVTDAKAL
FT                   AEGDEHHSPKKENFFEMLGEYIMAGFTVAVIVGAMLVGFIALIALINYLFEMAFGVNFQ
FT                   FVMGYLFYPIAWILGIPSGEALQAGSIMATKLVTNEFVAMMDLGKIAAQLSPRTIGILS
FT                   IFMVSFANFSSIGIIAGAVKALNEEKGNMVSRFGLKLVYGSTLVSLLSAVIAGVML"
     MIRCLRERLI NLKTFVLSNM HIFTADCDGY LIFKYANVYD GAGQKITNYS GATGMEYVHF        60
     VLGLVMVLAL ALLANRHNWK QIKLRYIGQL LVVELALAWF MLNSEVGLAV VGGFAAGFTK       120
     LMEFAKQGTD FVFGGLVNEG AFSFFLMVLM PIVFISVLIG ILQYIRLLPL VIRGIGTVLA       180
     KINGMGKLES FNAISSMIVG QSENFIALKN ILPHLNEKQM YTLAATAMST VSMSIVGAYM       240
     QLIEPRYVVA ALVLNMFSTF IVLSLINPYE PDNTVTDAKA LAEGDEHHSP KKENFFEMLG       300
     EYIMAGFTVA VIVGAMLVGF IALIALINYL FEMAFGVNFQ FVMGYLFYPI AWILGIPSGE       360
     ALQAGSIMAT KLVTNEFVAM MDLGKIAAQL SPRTIGILSI FMVSFANFSS IGIIAGAVKA       420
     LNEEKGNMVS RFGLKLVYGS TLVSLLSAVI AGVML                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page