(data stored in ACNUC7421 zone)

EMBL: CP000462.PE517

CP000462.PE517       Location/Qualifiers
FT   CDS             complement(575340..575894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0541"
FT                   /product="cytochrome B"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38696"
FT                   /db_xref="GOA:A0KFP8"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP8"
FT                   /protein_id="ABK38696.1"
FT                   /translation="MTTSEVKVWDPLIRVFHWATVTLCLLNFFVLEEGSKPHKYAGYTV
FT                   GILLIIRLLWGLVGPHYARFGQWWPTPARVRYYLRQLAQGSHPYYLGHNPVGALMIWLL
FT                   LLSLVGTVVTGWLTTWDAFWGEDWLEELHGIIANTLMAAVGVHAAVVILTDRLTRSDLV
FT                   RAMVLGKKRVPADAKVEDPRS"
     MTTSEVKVWD PLIRVFHWAT VTLCLLNFFV LEEGSKPHKY AGYTVGILLI IRLLWGLVGP        60
     HYARFGQWWP TPARVRYYLR QLAQGSHPYY LGHNPVGALM IWLLLLSLVG TVVTGWLTTW       120
     DAFWGEDWLE ELHGIIANTL MAAVGVHAAV VILTDRLTRS DLVRAMVLGK KRVPADAKVE       180
     DPRS                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page