(data stored in ACNUC7421 zone)

EMBL: CP000462.PE518

CP000462.PE518       Location/Qualifiers
FT   CDS             complement(575943..576212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAY38542.1"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38244"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP9"
FT                   /protein_id="ABK38244.1"
FT                   /translation="MKLTPLLLLIPLLSGAALADPQCTQADKSKWMSEADAQQQIKAMG
FT                   YDIKKFKVTKTNCYEIYGWDKEKRKVEIYFDPTDLKKVKEEIDE"
     MKLTPLLLLI PLLSGAALAD PQCTQADKSK WMSEADAQQQ IKAMGYDIKK FKVTKTNCYE        60
     IYGWDKEKRK VEIYFDPTDL KKVKEEIDE                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page