(data stored in ACNUC7421 zone)

EMBL: CP000462.PE519

CP000462.PE519       Location/Qualifiers
FT   CDS             complement(576334..576786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0543"
FT                   /product="YaiI/YqxD family protein"
FT                   /note="identified by match to protein family HMM PF02639"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39838"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFQ0"
FT                   /protein_id="ABK39838.1"
FT                   /translation="MPIWVDADACPIPVKEILYRAAHRAQVVTTLVANQGLRVPPSPFI
FT                   KTQQVEKGFDVADHVIAQQVKPGDLVITGDIPLASWVIDAGGEALNPRGEIYTRETIKA
FT                   RLGMRNFMEELRSAGVQTGGPAPLNAADKQRFANALDKWLIRGKLS"
     MPIWVDADAC PIPVKEILYR AAHRAQVVTT LVANQGLRVP PSPFIKTQQV EKGFDVADHV        60
     IAQQVKPGDL VITGDIPLAS WVIDAGGEAL NPRGEIYTRE TIKARLGMRN FMEELRSAGV       120
     QTGGPAPLNA ADKQRFANAL DKWLIRGKLS                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page