(data stored in ACNUC7421 zone)

EMBL: CP000462.PE520

CP000462.PE520       Location/Qualifiers
FT   CDS             576898..577884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0544"
FT                   /product="transporter, CorA-like family"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39346"
FT                   /db_xref="GOA:A0KFQ1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ1"
FT                   /protein_id="ABK39346.1"
FT                   /translation="MSKKDEQMDRVPSDVIYGLTLDGRGGMQPLVAGSEIPAQQPGWLH
FT                   LDYGNPEAARWLLQTPLLNDAARESLLGQSNRPKLVRMGETVLLILRGINHNKDHRPEE
FT                   MVALRIYITPDLIISSRRRPLLSEQDVFNQLKLGGGADTPADWLVEICDALTDRAGEFV
FT                   EELHDQILDLEEMVLMRDLPANGRLALIRKQLIMIRRYLSPQRDLVARLANEKISWLDE
FT                   DDRRRLLDIADRLRRWLDDLDAGVARTAVLADEINNLMAEATNRRAYQMSVMALLFLPA
FT                   SFLTGLFGINLGGIPGAESPTAFWIFCGSLVALATGLAVWLKHRRWW"
     MSKKDEQMDR VPSDVIYGLT LDGRGGMQPL VAGSEIPAQQ PGWLHLDYGN PEAARWLLQT        60
     PLLNDAARES LLGQSNRPKL VRMGETVLLI LRGINHNKDH RPEEMVALRI YITPDLIISS       120
     RRRPLLSEQD VFNQLKLGGG ADTPADWLVE ICDALTDRAG EFVEELHDQI LDLEEMVLMR       180
     DLPANGRLAL IRKQLIMIRR YLSPQRDLVA RLANEKISWL DEDDRRRLLD IADRLRRWLD       240
     DLDAGVARTA VLADEINNLM AEATNRRAYQ MSVMALLFLP ASFLTGLFGI NLGGIPGAES       300
     PTAFWIFCGS LVALATGLAV WLKHRRWW                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page