(data stored in ACNUC7421 zone)

EMBL: CP000462.PE53

CP000462.PE53        Location/Qualifiers
FT   CDS             60918..61556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0057"
FT                   /product="lysine exporter protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39777"
FT                   /db_xref="GOA:A0KEC1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC1"
FT                   /protein_id="ABK39777.1"
FT                   /translation="MFESLGVINVWTYLVGLFFIIIAPGPNSIYVLRTGASRGVGPGYQ
FT                   AALGVFVGDAILIFCAYLGIASLIRTTPLLFTLVRYLGALYLLYLGVKILHANFIARRE
FT                   GQASVVEHGERYFSKALTLSLTNPKAILFYVSFFVQFVDFNYAHTWVSYLVLASMLEAM
FT                   SFVYLTLLIFGGTLMARFFARKVRLARLGNGLIGLFFMGFAARLATLSS"
     MFESLGVINV WTYLVGLFFI IIAPGPNSIY VLRTGASRGV GPGYQAALGV FVGDAILIFC        60
     AYLGIASLIR TTPLLFTLVR YLGALYLLYL GVKILHANFI ARREGQASVV EHGERYFSKA       120
     LTLSLTNPKA ILFYVSFFVQ FVDFNYAHTW VSYLVLASML EAMSFVYLTL LIFGGTLMAR       180
     FFARKVRLAR LGNGLIGLFF MGFAARLATL SS                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page