(data stored in ACNUC7421 zone)

EMBL: CP000462.PE538

CP000462.PE538       Location/Qualifiers
FT   CDS             complement(596295..596750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39403"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR9"
FT                   /protein_id="ABK39403.1"
FT                   /translation="MPAGLTCIKTPSPQVRTMPCMTTHHSHPARPARADKAPVHPRLKR
FT                   EQQTVSAMIRLYCDHHHQDPVCRHCQQLQEFAHQRLRRCRYGHGHKPTCANCHIHCYAP
FT                   AMRKQIQLVMKWSGPRMLWHHPWLALRHLLDSRRKAPKRPGSRPLPP"
     MPAGLTCIKT PSPQVRTMPC MTTHHSHPAR PARADKAPVH PRLKREQQTV SAMIRLYCDH        60
     HHQDPVCRHC QQLQEFAHQR LRRCRYGHGH KPTCANCHIH CYAPAMRKQI QLVMKWSGPR       120
     MLWHHPWLAL RHLLDSRRKA PKRPGSRPLP P                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page