(data stored in ACNUC7421 zone)

EMBL: CP000462.PE540

CP000462.PE540       Location/Qualifiers
FT   CDS             complement(598639..599304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0564"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37245"
FT                   /db_xref="GOA:A0KFS1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS1"
FT                   /protein_id="ABK37245.1"
FT                   /translation="MTPPYKTRTQMVMENLRGRILRGEFPAGAPLRQDAIAKELAVSRI
FT                   PVREALMQLEAQGLVKFEAHRGAVVTMLDAAAIEELFYLRALLEADTLFHAVDLMTEET
FT                   FARAQAILAQFDQALESGTQIERWAELNHSFHATLYQAAGRPQALELIAQINLSCDRYV
FT                   RFELLFASDGVDKAEREHAQLLELCRARRKHEAVVLLKQHIEAAGQSIKRILDSGHNH"
     MTPPYKTRTQ MVMENLRGRI LRGEFPAGAP LRQDAIAKEL AVSRIPVREA LMQLEAQGLV        60
     KFEAHRGAVV TMLDAAAIEE LFYLRALLEA DTLFHAVDLM TEETFARAQA ILAQFDQALE       120
     SGTQIERWAE LNHSFHATLY QAAGRPQALE LIAQINLSCD RYVRFELLFA SDGVDKAERE       180
     HAQLLELCRA RRKHEAVVLL KQHIEAAGQS IKRILDSGHN H                           221
//

If you have problems or comments...

PBIL Back to PBIL home page