(data stored in ACNUC7421 zone)

EMBL: CP000462.PE543

CP000462.PE543       Location/Qualifiers
FT   CDS             complement(602248..602838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0567"
FT                   /product="heat shock protein 15"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35955"
FT                   /db_xref="GOA:A0KFS4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS4"
FT                   /protein_id="ABK35955.1"
FT                   /translation="MFINIFWHPNRLAIVYGNGPRDNRPDGMKLRKLTFRHTISPPVSI
FT                   PGPASGIIRHPFQPFRSRFMPNPAETPALVRLDKWLWAARFYKTRSLARDQIEGGKVHY
FT                   NGQRSKPGKHVEVGALIRFWQGQDEREVRVLEVSEQRKSAPLAQQLYEETEASLKKRAE
FT                   NSEARRFNSQFAPSPERRPDKQERRQLIKVKQY"
     MFINIFWHPN RLAIVYGNGP RDNRPDGMKL RKLTFRHTIS PPVSIPGPAS GIIRHPFQPF        60
     RSRFMPNPAE TPALVRLDKW LWAARFYKTR SLARDQIEGG KVHYNGQRSK PGKHVEVGAL       120
     IRFWQGQDER EVRVLEVSEQ RKSAPLAQQL YEETEASLKK RAENSEARRF NSQFAPSPER       180
     RPDKQERRQL IKVKQY                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page