(data stored in ACNUC7421 zone)

EMBL: CP000462.PE55

CP000462.PE55        Location/Qualifiers
FT   CDS             complement(62289..63905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED7"
FT                   /protein_id="ABK37902.1"
FT                   /translation="MNPAYKWLLAMVIATSWASQASAAVIKYNLVDADLRHFLFIENQE
FT                   DHNLFITPTDYLDPRLTGGNAWTTDSRQVSLAYADNGHNYTVTNYNIDMWENGPVKYPY
FT                   INQRCIKSWAGCDPQTAEAMNKPASVNETGFFGLMKAATGYAHAKLSSAFFGYLRTMPA
FT                   GGILNREMNLCMTTRIYDAAAGERCINQDSGTWYVKRTQHKKAGHLRFIQTNAISEVIV
FT                   DSNGAPYVLPGSQGCENYRLGTRDGVLCRFLDYDFNQDGSQSFSDPYIYTNIKNAALNS
FT                   AIVGGDVQMSANLTNWALKGADYNVSYLRGQSSIYLFLSSNFFKQVVRLGLQEQLTRNL
FT                   INFNMRNIKAPESGFYEFSGTTEIIIKPRDFSVSILSSEGVSNPYREGNVGKDILSFSY
FT                   NISDSGPISADMLEITVSQDIGAPYQGLCTFYPAGQAVPEQAVPIPTRLVFDSTNHGTA
FT                   SRHAVRCDQTPLDIRTLGIQDSQPPQEWNDPVSGKSITRFYKLALEFDLTDPMVQRTIG
FT                   NDLWEGEVQQSGTITIKGTWR"
     MNPAYKWLLA MVIATSWASQ ASAAVIKYNL VDADLRHFLF IENQEDHNLF ITPTDYLDPR        60
     LTGGNAWTTD SRQVSLAYAD NGHNYTVTNY NIDMWENGPV KYPYINQRCI KSWAGCDPQT       120
     AEAMNKPASV NETGFFGLMK AATGYAHAKL SSAFFGYLRT MPAGGILNRE MNLCMTTRIY       180
     DAAAGERCIN QDSGTWYVKR TQHKKAGHLR FIQTNAISEV IVDSNGAPYV LPGSQGCENY       240
     RLGTRDGVLC RFLDYDFNQD GSQSFSDPYI YTNIKNAALN SAIVGGDVQM SANLTNWALK       300
     GADYNVSYLR GQSSIYLFLS SNFFKQVVRL GLQEQLTRNL INFNMRNIKA PESGFYEFSG       360
     TTEIIIKPRD FSVSILSSEG VSNPYREGNV GKDILSFSYN ISDSGPISAD MLEITVSQDI       420
     GAPYQGLCTF YPAGQAVPEQ AVPIPTRLVF DSTNHGTASR HAVRCDQTPL DIRTLGIQDS       480
     QPPQEWNDPV SGKSITRFYK LALEFDLTDP MVQRTIGNDL WEGEVQQSGT ITIKGTWR         538
//

If you have problems or comments...

PBIL Back to PBIL home page