(data stored in ACNUC7421 zone)

EMBL: CP000462.PE559

CP000462.PE559       Location/Qualifiers
FT   CDS             617780..618340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0583"
FT                   /product="ADP compounds hydrolase NudE"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39771"
FT                   /db_xref="GOA:A0KFU0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU0"
FT                   /protein_id="ABK39771.1"
FT                   /translation="MAHDKSKPEILKAEIVAESRLFKVESLHLKFSNGEERVYERMRGG
FT                   SRGAVMVVPLFDAHTLLLVREYAAGTHSYELGFPKGLIDPGEDAFEAGNRELMEEAGFG
FT                   ANSLTLLKQVSLAPGYFSSRMDILLARDLFPEQRVGDEPEPLEVIPWPLNRIDELLARP
FT                   DFTESRSISALLLAQRWLAEQAE"
     MAHDKSKPEI LKAEIVAESR LFKVESLHLK FSNGEERVYE RMRGGSRGAV MVVPLFDAHT        60
     LLLVREYAAG THSYELGFPK GLIDPGEDAF EAGNRELMEE AGFGANSLTL LKQVSLAPGY       120
     FSSRMDILLA RDLFPEQRVG DEPEPLEVIP WPLNRIDELL ARPDFTESRS ISALLLAQRW       180
     LAEQAE                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page