(data stored in ACNUC7421 zone)

EMBL: CP000462.PE56

CP000462.PE56        Location/Qualifiers
FT   CDS             complement(63908..66385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36686"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED8"
FT                   /protein_id="ABK36686.1"
FT                   /translation="MPKSETMVRDMLKKTCLLPLSLLMVVSASANSAAPLKIANVIIPA
FT                   SFAQALAEGLAVPVRLQYTDEKNRLDTLTDNPIGNATLLLQDGKLHLLHIDFGAGQQQG
FT                   LLNDQLTAMLASEEKRTFSAEGSLQIDANASMQLDLVAMLLTIRVSRDAFGQARQPDNR
FT                   VTLTPTVDTLTGVHRYNLGYSFNSNRQNGHSDSNFLQLDSTVGMGAHHMALDASLYNLG
FT                   EPEQSGDIYRAMYERDLDDRRIAAGMVSTWDLQTLGVVTGLSTGRIYGASYGNQAQSRK
FT                   QKADTSTTPVQVFMPANGEVRVYREDRLISLQNLAIGNQNIDTSAFPSGVYNVTVEVYV
FT                   DGRLTSTTTQRVTKLGGSLGFTQEWGWQWWGGMMEGAQNNGDSPLLGVSLARSLDTLEL
FT                   ATTTYAFKDAAVGEARANWQATDRVSAQLQTMLASDQSWRFASSLALQAHDNASLWLSQ
FT                   EKLETGSALTVSNAELYSAGITLNLGGWVSGLGQLTFNTLHDRQMNSDRSYADYYQHLY
FT                   AGKYGNLSLRASLQSDSGTLNGFNNKSITLDYSIPFDNLFSFGMSSNEQGQTTANVNYQ
FT                   KRMDGVINLASFNASRMMHGSDEHNMALSGTLGFENRVIGGTMTLGRGHGGDMNGNLIA
FT                   RGALVTTEDALVASSRSSSGAGLIINTGIDRQGQMLAKVNGQDYPLHGEQTFLALPPYG
FT                   EYEIELLNSKRGKDSYDINTGKQRYTLFPGNVATLDASSTIKEMVTVFGILRAEDGSLL
FT                   ANARIDNHIGTTVTNEEGEFSLDVDKANPMLTFRQGNDFCEAELDLEKYSGAAWVGIIT
FT                   CQGLPTYAMVREY"
     MPKSETMVRD MLKKTCLLPL SLLMVVSASA NSAAPLKIAN VIIPASFAQA LAEGLAVPVR        60
     LQYTDEKNRL DTLTDNPIGN ATLLLQDGKL HLLHIDFGAG QQQGLLNDQL TAMLASEEKR       120
     TFSAEGSLQI DANASMQLDL VAMLLTIRVS RDAFGQARQP DNRVTLTPTV DTLTGVHRYN       180
     LGYSFNSNRQ NGHSDSNFLQ LDSTVGMGAH HMALDASLYN LGEPEQSGDI YRAMYERDLD       240
     DRRIAAGMVS TWDLQTLGVV TGLSTGRIYG ASYGNQAQSR KQKADTSTTP VQVFMPANGE       300
     VRVYREDRLI SLQNLAIGNQ NIDTSAFPSG VYNVTVEVYV DGRLTSTTTQ RVTKLGGSLG       360
     FTQEWGWQWW GGMMEGAQNN GDSPLLGVSL ARSLDTLELA TTTYAFKDAA VGEARANWQA       420
     TDRVSAQLQT MLASDQSWRF ASSLALQAHD NASLWLSQEK LETGSALTVS NAELYSAGIT       480
     LNLGGWVSGL GQLTFNTLHD RQMNSDRSYA DYYQHLYAGK YGNLSLRASL QSDSGTLNGF       540
     NNKSITLDYS IPFDNLFSFG MSSNEQGQTT ANVNYQKRMD GVINLASFNA SRMMHGSDEH       600
     NMALSGTLGF ENRVIGGTMT LGRGHGGDMN GNLIARGALV TTEDALVASS RSSSGAGLII       660
     NTGIDRQGQM LAKVNGQDYP LHGEQTFLAL PPYGEYEIEL LNSKRGKDSY DINTGKQRYT       720
     LFPGNVATLD ASSTIKEMVT VFGILRAEDG SLLANARIDN HIGTTVTNEE GEFSLDVDKA       780
     NPMLTFRQGN DFCEAELDLE KYSGAAWVGI ITCQGLPTYA MVREY                       825
//

If you have problems or comments...

PBIL Back to PBIL home page